MBC logo Molecular Bioinformatics Center
  National Chiao Tung University  
Home About (PS)2 CASP8 Sample output New (PS)2 version 3.0      
(PS)2-v2: Protein Structure Prediction Server
 
Target name :
Q03096
Seq. length :
181
Sequence :
Secondary
structure :
S2A2 search :
 
Template Seq-len Aligned (%) Identity (%) SW-score Bit-score E-value
2i46A15287.8517.61220.9120.30.014
2i46B13487.8513.84190.9105.50.096
2qf4A17086.7416.67174.294.80.38
2a22B20366.8512.21174.894.50.39
3c7fA48787.8520.47187.493.00.47
1bmlC31898.9016.41193.292.90.48
1sgfA20398.3417.01167.690.30.67
1opoC26888.4015.76185.389.40.75
2rdeB22584.5316.46171.289.20.77
2be1A30179.5616.99172.088.60.83
1ud9A24282.8710.39173.488.40.85
2jqvA16593.9214.12154.488.10.88
 
Alignment
 

>2i46A 
 
Template = 2i46A, Q_len = 181, S_len = 152, Score = 220.9 
Aligned = 87.85%, Identnties = 17.61%, SS_identities = 66.67% 
 
Query: 17 FLQPWIKALIEDNSEHDQYHPSGHVIPSLTKQDLALPHMSPTILTNPCHFAKITKFYNVCDYKVYASIRDSSHQILVEFS 96 
EeChhHHHHccCcCCCCCeeEEEEEEEEEcCCCCCccccccccCCCCCCcCCCCcccccCCCeEEEEEECCCCEEEEEEC 
L+PWI+ LI SE +G ++ L + A + P H A T D + D +H + + 
EcCccHHHHhhC-CCCCCccEEEEEEEEEeCCCCC--------CCCCCC-CCCC-----CCCcEEEEEECCCCEEEEEEC 
Sbjct: 5 VLRPWIRELILG-SETPSSPRAGQLLEVLQDAEAA--------VAGPSH-APDT-----SDVGATLLVSDGTHSVRCLVT 69 
 
Query: 97 QECVSNFERTHNCRITSETTNCLMIIGDADLVYVTNSRAMSHFKICLSNISSKEIVPVLNVNQATIFDIDQVGSLSTFP 175 
HHHHHhhhhhCCCeeeCCCCCEEEEEEEEEeEEEECcccccccceeeECccCcCeEEEEEEEEEEEEcccCccCCCCCC 
+E + + T L+++ D V+V L V++ ++ +Q P 
HHHHHcccccCCCcccCCCCCEEEEEEEEE-EEEEC----------cEC--CeCcEEEEEEEEEEEEeeeC--CCCCCC 
Sbjct: 70 REALDTSDWEEKEFGFRGTEGRLLLLQDCG-VHVQV----------AEG--GAPAEFYLQVDRFSLLPTEQ--PRLRVP 133 
 
 
 

>2i46B 
 
Template = 2i46B, Q_len = 181, S_len = 134, Score = 190.9 
Aligned = 87.85%, Identnties = 13.84%, SS_identities = 59.12% 
 
Query: 17 FLQPWIKALIEDNSEHDQYHPSGHVIPSLTKQDLALPHMSPTILTNPCHFAKITKFYNVCDYKVYASIRDSSHQILVEFS 96 
EeChhHHHHccCcCCCCCeeEEEEEEEEEcCCCccccccccccccccccccccccccccccCeEEEEEECCCCEEEEEEC 
L+PWI+ LI SE +G ++ L + + D +H + + 
EcCccHHHHhhC-CCCCCccEEEEEEEEEeCCC----------------------------CcEEEEEECCCCEEEEEEC 
Sbjct: 5 VLRPWIRELILG-SETPSSPRAGQLLEVLQDAE----------------------------VGATLLVSDGTHSVRCLVT 55 
 
Query: 97 QECVSNFERTHNCRITSETTNCLMIIGDADLVYVTNSRAMSHFKICLSNISSKEIVPVLNVNQATIFDIDQVGSLSTFP 175 
HHHHHhhhhhCCCeeeCCCCCEEEEEEEEEeEEEECCCCCCccceeeecccccCeEEEEEEEEEEEEcccCccCCCCCC 
+E + + T L+++ D V+V + + L V++ ++ +Q P 
HHHHHc----CCCcccCCCCCEEEEEEEEE-EEEECCCCCC------------CcEEEEEEEEEEEEeeeC--CCCCCC 
Sbjct: 56 REALDT----SDWFGFRGTEGRLLLLQDCG-VHVQVAEGGA------------PAEFYLQVDRFSLLPTEQ--PRLRVP 115 
 
 
 

>2qf4A 
 
Template = 2qf4A, Q_len = 181, S_len = 170, Score = 174.2 
Aligned = 86.74%, Identnties = 16.67%, SS_identities = 67.28% 
 
Query: 4 VILESHSKPTDSVFLQPWIKALIEDNSEHDQYHPS-GHVIPSLTKQDLALPHMSPTILTNPCHFAKITKFYNVCDYKVYA 82 
EEEcCCCCCCCEEEEChhHHHhCCCCccccCEEEE-eEEEEEEcccCccCCCcccccCCCCcCCCCCccccccCCcEEEE 
VI+ S + L +N + G +I S++K + +LTN + KI+ +Y 
EEEeCCCCCCCEEEECccHHHcCCCC----CEEEEccEEEEEEeeeC--CCCeeeeeCCCCeCCCCCeeeeeeCCeEEEE 
Sbjct: 11 VIMRSPVSWKQELTLDAGRSKGASEN----MLAIANGGLIGSVSKVE--ENSTIVNLLTNTENADKISVKIQHGSTTIYG 84 
 
Query: 83 SI--RDSSHQILVEFSQECVSNFERTHNCRITSETT-N-CLMIIGDADLVYVTNSRAMSHFKICLSNISSKEIVPVLNVN 158 
EE--EcCCCeEEEEEChhhhhhhhhhCCCEEEccCC-C-eeEEEEEEEEEEEECCCCCCCCcEEEEcCCCCCeeeEEEEE 
I D + +L N + + ++T+ N + I ++V T+S ++ + + V V+ + 
EEeeEeCCCcEEEEECccc--cccccCCCEEEeeCCcCcccEEEEEEEEEEEECCCCCCCCeEEEEeCCCCCcccEEEEE 
Sbjct: 85 IIIGYDKENDVLKISQLNS--NSDISAGDKVTTGGLGNFNVADIPVGEVVATTHSTDYLTREVTVKLSADTHNVDVIELV 162 
 
Query: 159 QA 160 
EE 
 
EE 
Sbjct: 163 GN 164 
 
 
 

>2a22B 
 
Template = 2a22B, Q_len = 181, S_len = 203, Score = 174.8 
Aligned = 66.85%, Identnties = 12.21%, SS_identities = 68.70% 
 
Query: 43 PSLTKQDLALPHMSPTILTNPCHFAKITKFYNVCDYKVYASIRDSSHQILVEFS--------QECVSNFERTHNC--RIT 112 
EEECCCCCCCCCCCCCCCCCcccccccccccCCccCeeEEEEEcCCcEEEEEeC--------HHHHHHHHHHCCC--EEE 
+ DL +P +N V + Y ++ +I + + ++R +C +T 
EEECCCCCCCCCCCCCCCCC-----------CC--CccEEEEEeCCeEEEEEcCccccccccHHHHHHHHHHCCCceEEE 
Sbjct: 69 VYIVSGDLDSAIFNPDPESN-----------GV--FPEYVVVQIGEFKIGLMHGNQVLPWDDPGSLEQWQRRLDCDILVT 135 
 
Query: 113 SETTNCLMIIGDADLVYVTNSRAMSHFKICLSNISSKEIVPVLNVNQATIF 163 
CCCcCeeEEEEEeeEEEEECCCCCCCCCeeeeCCCCccEEEEEEeeEEEEE 
T + L + +++ A F + ++ L N+ ++ 
CCC-CccEEEEEccEEEEECCCCCCCCCccccCCCCeeEEEEEEccEEEEE 
Sbjct: 136 GHT-HKLRVFEKNGKLFLNPGTATGAFSALTPDAPPSFMLMALQGNKVVLY 185 
 
 
 

>3c7fA 
 
Template = 3c7fA, Q_len = 181, S_len = 487, Score = 187.4 
Aligned = 87.85%, Identnties = 20.47%, SS_identities = 62.57% 
 
Query: 15 SVFLQPWIKALIEDNSEHDQYHPSGHVIPSLTKQDLALPHMSPTILTNPCHFAKITKFYNVCDY-KVYASIRDSSHQILV 93 
EEEECHHHHHHcCCccccCCeeeEEEEEEeecCCCcccccccCCcCCCCCCCCCCCCCCCcCCC-eEEeeEECccceeEE 
Q AL + + S H+ + D +I ++A +T+ N+ Y +V A + +IL 
EEEECHHHHHHhCC----CCcccEEEEEEcceCCC-------CCeCCCCCCCCCCCCCCCeCCCccEEccEECeeeccEE 
Sbjct: 303 VYHAQTVSSALFGA----GKGYRSPHINKLVHNAD-------GSIQEVAANYAGVTQISNLNPYNRVEAETFAWNGRILT 371 
 
Query: 94 EFSQECVSNFERTHNCRITSETTNCLMIIGDAD------LVYVTNSRAMSHFKICLSNIS-SKEIVPVLNV----NQATI 162 
EEChhhhhhhhhhCCcEEECCCCCeEEEEEEEE------EEEEEccccCCCccEEEEcCC-CCCEEEEEEE----EEEEE 
E S + +N +TS + +G+AD + N + KI + S ++V LNV T 
EEC---cccccccCCeEEECCCCCcEEEEEEEEccccceEEEEEeeeeCCCeeEEEEeCCcCCCEEEEEEEccccEEEEE 
Sbjct: 372 EKS---TAPGGPVNNQHVTSIQNGDWIAVGNADFGAGGARSFKANVASTLGGKIEVRLDSADGKLVGTLNVPSTGGAQTW 448 
 
Query: 163 FDIDQVGSLST 173 
EcccccCCCCC 
+I+ S +T 
EeeeeeCCCCC 
Sbjct: 449 REIETAVSGAT 459 
 
 
 

>1bmlC 
 
Template = 1bmlC, Q_len = 181, S_len = 318, Score = 193.2 
Aligned = 98.90%, Identnties = 16.41%, SS_identities = 64.10% 
 
Query: 3 KVILESHSKPTDSVFLQPWIKALIEDNSEHDQYHPSGHVIPSLTKQDLALPHMSPTILTNPCHFAKITKFYNVCDYKVYA 82 
CEEecccCCCCCEEEEchhhhhhccCCCCCCCEEEEEEEEEEECCcccccccccccccCCCccCCCcCCCccccccEEEE 
KV + SV L ++ SGHV K P K +V +Y V 
CEEc---CCCCCEEEE---------CCCCCCCEEEEEEEEEEECC-------------CCC--CCCeCCCeee-eeEEEE 
Sbjct: 79 KVYF---ADKDGSVTL---------PTQPVQEFLLSGHVRVRPYK-------------EKP--IQNQAKSVDV-EYTVQF 130 
 
Query: 83 SIRD--SSHQILVEFS-------QECVSNFERTHNCRITSETTNCLMIIGDADLVYVTNS-----RAM-SHFKICLSNIS 147 
EEeC--CCCEEEEEEC-------HHHHHHHHHHccceeecCCCCeEEEEEEEEEEEEeCC-----CCC-CCCcEeeeCCc 
+ + ++L + QE ++ + N + D+ +V N M F + N 
EEcCccCCCEEEEEECcccceehHHHHHHHHHHhh----hCCCCcEEEEEEEEEEEEcCCccceeCCCcCCCeEcccCCe 
Sbjct: 131 TPLNPDDDTKLLKTLAIGDTITSQELLAQAQSILN----KTHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYHVKNRE 206 
 
Query: 148 SKEI-VPVLNVNQATIFDIDQVGSLSTFPFVYKYL 181 
CCCe-EEEEEEEEEEEECcccCCCCCCCCCCCCCC 
EI L + + G PF +L 
CCCccEEEEEEEEEEEEC---CCCCCCCCCCCCCC 
Sbjct: 207 QAEINNTDLISEKYYVLK---KGEKPYDPFDRSHL 238 
 
 
 

>1sgfA 
 
Template = 1sgfA, Q_len = 181, S_len = 203, Score = 167.6 
Aligned = 98.34%, Identnties = 17.01%, SS_identities = 60.31% 
 
Query: 4 VILESHSKPTD-SVFLQPWIKALIEDNSEHDQYHPSGHVIPSLTKQDLALPHMSPTILTN--------PCHFAKITK--- 71 
EEECcccCCCC-EEEEChhhhhhcCCCCccCcEEEEEEEEEeeCCCCCCCCCCCCcCCCC--------CCCCCCCCC--- 
V+ +H V+L E+ S DQ+ IP LP + P + K 
EEEChhhCCCCcEEEECc------CCCC--CeEEEEEEEEEccCCCCCCCCCCCCeCCCCceeeeeccCCCCCCCCCccc 
Sbjct: 27 VLTAAHCYNDKYQVWLGK------EEPS--DQHRLVSKAIPHPDFNMSLLPQPEDDYSNDLMLLRLSKPADITDVVKPIT 98 
 
Query: 72 ---FYNVCDYKVYASIRDSSHQILVEFS-QECVSNFERTHNCRITSETTNCLMIIGDADLVYVTNSRAMSHFKICLSNIS 147 
---CCCCCCCEEEEeeecccCEEEEEEC-HHHHhhhhhhCCCEeeccccCeEEEEEEeeeeEEECccccCCcceeeecCC 
ASI L ++C H ++T + ++ G+ D T H S 
cccCCCCCCCEEEEcc----CEEEEEECcHHHHcc----CCCEcc----CcEEEEEEccccEEEC----CC-------CC 
Sbjct: 99 LPTEEPKLGSTCLASI----CVNLKLLPNEDCDKA----HEMKVT----DAMLCAGEMDGGSYTC----EH-------DS 155 
 
Query: 148 SKEIVPVLNVNQATIFDIDQVGSLSTFPFVYKYL 181 
CCcEEEeeEEEEEEeeCCCCCCCcCCCCcccccC 
++ + T + + G T P VY L 
CCeEEEccEEEEEEccCCCCCCC-CCCCeeeeeC 
Sbjct: 156 GGPLICDGILQGITSWGPEPCGE-PTEPSVYTKL 188 
 
 
 

>1opoC 
 
Template = 1opoC, Q_len = 181, S_len = 268, Score = 185.3 
Aligned = 88.40%, Identnties = 15.76%, SS_identities = 59.24% 
 
Query: 4 VILESHSKPTDSVFLQPWIKALIEDNSEHDQYHPSGHVIPSLT------KQDLALPHMSPTILTNPCHFAKITK--FYNV 75 
EEECCCCCCCceeeeCHHHHHHcCcccCcCcEEEEEEEEEEEc------CCcccccccCCCCCCCCcccccCCc--ccCC 
++ + P + L ++Y + + +AL T P TK FY++ 
EEECCCCCCC-----CHHHHHHhC---CeCeEEEEEEEEEEEeccccccCCeeeeeeeCCCCCCCC-----CChhhhhCC 
Sbjct: 27 WVVSPRNVAV-----FPQLSLLAT---NFNKYRITALTVKYSPACSFETNGRVALGFNDDASDTPP-----TTKVGFYDL 93 
 
Query: 76 CDYKVYASIRDSSHQILV------EFSQECVSN-FERTHNCRITSETT---NCLMIIGDADLVYVTN-SRAMSHFKI-CL 143 
ccCEEEEEEeCCCcEEEE------EEChhhhhh-HHHHCCcEEEcccc---CeeeEEEEEEEEEEEc-CCcCCCCCe-EE 
K + ++ +++ F ++ S+ + RI T ++G+ + Y S KI 
--CEEEEEEcCCCeEEEEccccccEECcccccccHHHHCCeEEEeeeececCcccEEEEEEEEEEEeeCCeCCCCCccEE 
Sbjct: 94 --GKHVETAAQTAKDLVIPVDGKTRFIRDSASDDAKLVDFGRIVLSTYGFDKADTVVGELFIQYTIVLSDPTKTAKISQA 171 
 
Query: 144 SN--ISSKE--IVPVLNVNQATIF 163 
EC--CcCCC--EEEEEEeeEEEEE 
SN +S +VP +N N+ + 
ECccCeCCCccEEEEEEccEEEEE 
Sbjct: 172 SNDKVSDGPTYVVPSVNGNELQLR 195 
 
 
 

>2rdeB 
 
Template = 2rdeB, Q_len = 181, S_len = 225, Score = 171.2 
Aligned = 84.53%, Identnties = 16.46%, SS_identities = 59.76% 
 
Query: 13 TDSVFLQPWIKALIEDNSEHDQYHPSGHVIPSLTKQDLALPHMSPTILTNPCHFAKITKFYNVCDYKVYASIRDSSHQIL 92 
CCEEEEchHHHHHCCccCCCcceeeeeEEEEEEcCcccccccccccccccCccccccCCCccccccEEEEEEECCCcEEE 
T S AL EH S + S+T P VC + +L 
CCEEEE--HHHHHCC--CCC-----ccEEEEEEeC---------------C------CCCeeee-eEEEEEEECCC-EEE 
Sbjct: 1 TVSTIN--STDALAM--VEH-----SSELTLSITT---------------P------VGTKFVC-RTPFIGTHTDK-FLL 48 
 
Query: 93 VEFSQECVSNFERTHN------CRITSETTNCLMIIGDADLVYVTNSR-AMSHFK----ICLSNISSKEIVPVLNVNQAT 161 
EEeChhhHHHHHHHCC------cEEEcCCcCeEEEEEEEEEEEEECCC-Cccccc----EEEECCCcCCeEEEEEEEEEE 
VE + + + R S +I + L+++ M+ + +S + KE LN+ 
EEcCcccHHHHHHHCCccceeeeEEEeCCeCcEEEEEEEEEEEEECCCcCeeeeeccceEEEECCC-CCcEEEEEEEEEE 
Sbjct: 49 VEMPKISADDLQYFFQEGFWMNIRAISPRGEGALIHFRSQLMHILQEPVPMAFLSIPNTMQVSQLR-KEPRFELNLAGKV 127 
 
Query: 162 IFDI 165 
EECC 
+FD 
EECC 
Sbjct: 128 LFDE 131 
 
 
 

>2be1A 
 
Template = 2be1A, Q_len = 181, S_len = 301, Score = 172.0 
Aligned = 79.56%, Identnties = 16.99%, SS_identities = 68.63% 
 
Query: 31 EHDQYHPS---GHVIPSLTKQDL-ALPHMS-PTILTNPCHFAKITKFYNVCDYKVYASIRDSSHQILVEFSQECVSNFER 105 
CCCcEEEE---eEEEEEECcccC-CCccCC-CCCCCCccCcccccCCCCccCCEEEEEEeCCccEEEEEEcHHHHhhhhh 
E + GH+I S+ ++ L + P+ L + I + + D +Y Q L ++ VS 
CCCeEEEEccccEEEEEEChhhCcCCeeCCcCCCCCC--CeeeeeCCCC--CCEEEEEEcCCeeEEEEEEhHHHHc---- 
Sbjct: 19 EGGLHAVDRRNGHIIWSIEPENFQPLIEIQEPSRLET--YETLIIEPFG--DGNIYYFNAHQGLQKLPLSIRQLVS---- 90 
 
Query: 106 THNCRITSETTNCLMIIGDADLVYVTNSRAMSHFKICLSNISSK----EIVPVLNVNQATIFDIDQVGSLSTF 174 
hCCcEEECCCcCEEEEEeEEEEEEEEccCCCCCccEEEECCCCc----cEEEEEEEEEeEEeCCCCCCCCCcc 
T + + + + G + T + I SK IV + + I D T+ 
cCCeEEECCC-CEEEEEcEEEEEEEEeeCCCCC-eEEEECCCCecccceEEEEEEEEEcEEcCCCCCCCCCee 
Sbjct: 91 TSPLHLKTNE-DEKVYTGSMRTIMYTINMLNGE-IISAFGPGSKNGENMIVIGKTIFELGIHSYDGASYNVTY 161 
 
 
 

>1ud9A 
 
Template = 1ud9A, Q_len = 181, S_len = 242, Score = 173.4 
Aligned = 82.87%, Identnties = 10.39%, SS_identities = 64.94% 
 
Query: 15 SVFLQPWIKALIEDNSEHDQYHPSGHV--IPSLTKQDLALPHMSPTILTNPCHFAKITKFYNVCDYKVYASIRDSSHQIL 92 
EEEEcHHHHHHcCCCCCCCCEEEEEEE--EEEEccCccccCCCCccccccCcccCCCCCCCCCCCCeEEEEEEcccceee 
F ++ L++ ++ + LT ++ N ++ ++ + A+I S 
EEEEhHHHHHHhCCCCCCCCEEEEEEEccEEEEeeC----CCCCeeeeeeC---CCCCCCCCCCCCcEEEEEEhhhh--- 
Sbjct: 67 FGFNTQYMSKLLKAAKRKEEIIIDADSPEVVKLTLS----GALNRVFNVNN---IEVLPPEVPLEFDIKATINASGL--- 136 
 
Query: 93 VEFSQECVSNFERTHNCRITSETTNCLMIIGDADLVYVTNSRAMSHFKICLSNISSKEIVPVLNVN--QATIFD 164 
eeecHHHHHHHHHHCcceeeccccCEEEEEEeeeEEEEEcCcCCCCCCEEEEcccCCceEEEEEEe--EEEEEc 
+ + + L+I G+ + V V + ++ S + + + N ++ +D 
----HHHHHHHHHHC---------CEEEEEEcccEEEEEeC-CCCCCCEEEEhhhCC--EEEEEEcccEEEEEe 
Sbjct: 137 ----KNAIGEIAEVA---------DTLLISGNEEKVVVKGE-GENKVEVEFSKDTGS--LADIEFNKESSSAYD 194 
 
 
 

>2jqvA 
 
Template = 2jqvA, Q_len = 181, S_len = 165, Score = 154.4 
Aligned = 93.92%, Identnties = 14.12%, SS_identities = 55.37% 
 
Query: 7 ESHSKP-TDSVFLQ-----PWIKALIEDNSEHDQYHPSGHVIPSLTKQDLALPHMSPTILTNPCHFAKITKFYNVCDY-K 79 
CCCCCC-CcEEEEC-----HHHHHHcCCcccccceeeeeEEEEEEccCcccCccCCCCCCCCCCccccccCccccCCC-E 
+ S P + +VF+ P + A+I D + +P++ L PC I D K 
CCCCCCcCeEEEECcccccHHHHHHhCC--------cccEEEEEEeeC---CeeCCCCCCCCCC----eeC----CCCcE 
Sbjct: 1 STSSDPQSHNVFVYGSILEPAVAAVILD--------RTADTVPAVLHG---YHRYKLKGLPYPC----IVS----SDSGK 61 
 
Query: 80 VYASIRDSSHQILVEFSQECVSNFERTHNCRITSETTNCLMIIGDADLVYVTNSRAMSHFKICLSNISSKEIVPVLNVNQ 159 
EEEEEecccceeEEEECHHHHHHHHHhccceeecccCCeeEEEEEEEEEEeeCCccccccceeeecccccceeEEEEEEE 
V + + S ++NF+ ++V + NS + V 
EEEEE-------EEEECHHHHHHHHHc---------CCccEEEEEEEEEEccCC-------------------EEEEEEE 
Sbjct: 62 VNGKV-------ITGVSDAELNNFDVI---------EGNDYERVTVEVVRMDNS-------------------EKVKVET 106 
 
Query: 160 ATIFDIDQVGSLSTFPF 176 
EEEeCCCCCCCCCCCCc 
+ D + F 
EEEcCCCCCCCCCCCCh 
Sbjct: 107 YVWVNKDDPRMYGEWDF 123 
 
 
                  Contact
Chen CC, Hwang JK, Yang JM. (PS)2: protein structure prediction server. NAR 2006, 34, W152-W157
Chen CC, Hwang JK, Yang JM: (PS)2-v2: template-based protein structure prediction server. BMC Bioinformatics 2009, 10:366